Anopheles gambiae (malaria mosquito): 1271007 Help Entry 1271007           CDS       T01036                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism aga  Anopheles gambiae (malaria mosquito) Pathway aga04070   Phosphatidylinositol signaling system aga04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:aga00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     1271007  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     1271007  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aga01009]     1271007   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aga04131]     1271007    03036 Chromosome and associated proteins [BR:aga03036]     1271007   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aga04147]     1271007 Protein phosphatases and associated proteins [BR:aga01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      1271007 Membrane trafficking [BR:aga04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     1271007 Chromosome and associated proteins [BR:aga03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      1271007 Exosome [BR:aga04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    1271007 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen DUF1103 Caleosin TerB FCaBP_EF-hand DUF5580_M SPEF2_C MotA_activ Fe_hyd_lg_C SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  1271007 NCBI-ProteinID:  XP_061511897 LinkDB All DBs Position 3:71720132..71752972 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVTMMTSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcaacttacggaagaacagatcgctgaattcaaagaagcgttctcgctgttc gacaaggacggcgatggcacaatcaccaccaaggaattaggcaccgtgatgcgatcgcta ggccagaaccccacagaagctgaattgcaagacatgatcaacgaagtcgacgcggacggt aacggcacgatcgatttccccgagtttctaacaatgatggctcgtaaaatgaaggacacg gacagtgaagaggaaatccgggaggcattccgagtcttcgacaaggacggcaacggtttt atctctgcagctgagctgcgccacgtcatgactaatctgggcgagaagctaacagacgag gaggtcgacgagatgatccgtgaagccgatatagatggcgatggccaggttaattatgaa gaattcgtaacaatgatgacatcgaagtga

DBGET integrated database retrieval system