Anopheles gambiae (malaria mosquito): 1273825 Help Entry 1273825           CDS       T01036                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism aga  Anopheles gambiae (malaria mosquito) Pathway aga04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aga00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     1273825  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aga04121]     1273825    03400 DNA repair and recombination proteins [BR:aga03400]     1273825 Ubiquitin system [BR:aga04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      1273825    Cul5 complex      1273825 DNA repair and recombination proteins [BR:aga03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      1273825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin GABP-alpha Rad60-SLD Motif Other DBs NCBI-GeneID:  1273825 NCBI-ProteinID:  XP_003436412 UniProt:  F5HL08 LinkDB All DBs Position 2:33137290..33139637 Genome browser AA seq 117 aa AA seqDB search MDVFMMIRRKKTTIFTDAKETTPVYELKKMIEGILKVPPRDQRLYNKDNMLMDDDKTLQD CGITVVTAKAQCPAQLGLAVRENGDFESLELTPYSLPPDLPDVMKNQDTANGQDQLA NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttatgatgatccggcggaagaagacgacgattttcaccgatgccaaagag acgacgccggtgtacgagctgaagaaaatgatcgaaggaatactcaaagtgcctccccgt gatcaacgactatacaacaaagacaacatgctgatggacgatgacaaaacgctgcaggac tgcggcatcacggtcgtgacagcgaaagcgcaatgccccgcacagctcggcctagcggtg cgcgaaaatggcgacttcgagtcgctcgagctgacaccctactccctgccgcccgaccta ccggacgtgatgaaaaaccaggataccgccaacggccaggaccagctcgcctaa

DBGET integrated database retrieval system