Anopheles gambiae (malaria mosquito): 1276139 Help Entry 1276139           CDS       T01036                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism aga  Anopheles gambiae (malaria mosquito) Pathway aga04013   MAPK signaling pathway - fly aga04145   Phagosome aga04148   Efferocytosis aga04310   Wnt signaling pathway aga04620   Toll-like receptor signaling pathway aga05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aga00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     1276139    04310 Wnt signaling pathway     1276139  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     1276139    04148 Efferocytosis     1276139  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     1276139  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     1276139  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aga04131]     1276139   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aga04147]     1276139    04031 GTP-binding proteins [BR:aga04031]     1276139 Membrane trafficking [BR:aga04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     1276139  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     1276139   Macropinocytosis    Ras GTPases     1276139  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     1276139 Exosome [BR:aga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    1276139   Exosomal proteins of other body fluids (saliva and urine)    1276139   Exosomal proteins of colorectal cancer cells    1276139   Exosomal proteins of bladder cancer cells    1276139 GTP-binding proteins [BR:aga04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     1276139 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  1276139 NCBI-ProteinID:  XP_315449 UniProt:  Q7PNL6 LinkDB All DBs Position 2:complement(84470003..84480258) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNIPIILVGTKLDLR DDKNTVDKLRDKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPM IPPKKKPKCNIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgatcaaatgtgtcgtcgtcggtgacggtgccgtcggtaagacgtgcctgctg atcagctacacaacgaacgcgttcccgggcgagtacatcccgaccgtgttcgacaactac tccgcgaacgtgatggtcgacggcaaaccgatcaacctcgggctgtgggatacggccggg caggaggattacgatcggctgcggcccctgtcctacccgcagacggacgtgtttctcata tgcttctcgctcgtcaatccggcctcgttcgagaacgtgcgggcgaaatggtacccggag gtgcgccaccactgtccgaacataccgatcatactggtcgggacgaagctcgatctgcgg gatgacaagaacacggtggacaagctgcgggacaagaagctgtcgccgatcacgtacccg caggggctggccatggccaaggagatcggtgcggtcaagtacctcgagtgttcggcgctg acgcagaagggcctcaagacggtgttcgacgaagcgatccgggcggtgctctgtccgatg attccgccgaagaagaaacccaagtgtaacatcctctaa

DBGET integrated database retrieval system