Agathobaculum sp. NTUH-O15-33: RWV98_11105 Help Entry RWV98_11105       CDS       T09495                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism agat  Agathobaculum sp. NTUH-O15-33 Brite KEGG Orthology (KO) [BR:agat00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:agat03032]     RWV98_11105    03036 Chromosome and associated proteins [BR:agat03036]     RWV98_11105    03400 DNA repair and recombination proteins [BR:agat03400]     RWV98_11105 DNA replication proteins [BR:agat03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RWV98_11105 Chromosome and associated proteins [BR:agat03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RWV98_11105 DNA repair and recombination proteins [BR:agat03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RWV98_11105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_2 HU-HIG DUF2267 HU-CCDC81_euk_1 HU-CCDC81_bac_2 YmgD Motif Other DBs NCBI-ProteinID:  WNX83158 LinkDB All DBs Position complement(2231685..2231963) Genome browser AA seq 92 aa AA seqDB search MKKSDFVTMVAEQAELSKKDTEKVIDVVFAALGDVLAQNDKLQISGFGTFETKERAARTG HNPRTGEAIEIAAATMPVFKPGKALKDKLNEQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaaagcgatttcgtgacgatggtagcggagcaggccgagctttctaagaaggat actgaaaaggtgatagacgttgtgtttgccgcgctgggcgacgtactggcgcagaacgac aagctgcagatcagcggcttcggcacatttgaaaccaaggagcgcgccgcgcgcacgggc cataatccccgcaccggcgaagccattgagattgccgctgctaccatgcccgtattcaag cccggcaaggctctgaaggacaagctgaacgaacagtga

DBGET integrated database retrieval system