KEGG   Anoplophora glabripennis (Asian longhorned beetle): 108905837
Entry
108905837         CDS       T07402                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
agb  Anoplophora glabripennis (Asian longhorned beetle)
Pathway
agb00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:agb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    108905837
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:agb00199]
    108905837
Enzymes [BR:agb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     108905837
Cytochrome P450 [BR:agb00199]
 Cytochrome P450, animal type
  CYP306 family
   108905837
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 108905837
NCBI-ProteinID: XP_018564384
LinkDB
Position
Unknown
AA seq 511 aa
MYANYCTEKMMLIIILVTILIFLLTYTFWKNMDLPPGPWGLPVLGYLPWIDSKAPYLTFT
QLSKKYGSIYGLSLGSIYTVVVTEPKVIKHLFFKDATIGRAPLYLTHGIMKGYGLICAEG
ELWKEQRRFVHHCLREFGGSKIGFQRKKMEALIMENVMDFVNFVESQGDKSTLDPLEPLR
HSLGSAMNILVFGKSWSRDDKTWKWLQHLQEEGTQHIGVAGPLNFLPFLRFHPKFGKTMD
FLISGKLETHKVYKKIIQEQAEYLKNRAQGDSSTDTNSITNITQAFLAERERRKDEPEIL
EKFYNDQQFYHLLADIFGAGLDTTLTTLRWYLLYLAKNPAIQRNIRIEIHDVLQNNLPTI
EDIAHLPLVEASIYEAQRIRSVVPVGIPHGATEEVEVDGFRIPQGSMIVPLQWAVHMNEN
MWPDPEKFDPSRFINEEGKVVRNSYFMPYQIGKRMCVGDELARMMLYLFGATILQKFSVE
LEDEHVDLIGVCGITLTPNSHKLIFSKVSSK
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtatgcaaattactgtacggaaaaaatgatgttaataatcatacttgtaaccatactg
atcttcctattgacttacacattttggaagaatatggacctcccgccaggcccgtgggga
ttacccgtgctgggatacttaccctggatcgattctaaagctccatatttaacatttacc
caactttcgaaaaaatatggatctatttatggtttatctctgggaagcatttatacggtg
gttgttacggaaccaaaagtcatcaaacatctcttttttaaagacgccaccattggtagg
gcgccactttacttaacccatgggataatgaaaggatatggtctaatttgcgccgaagga
gagctatggaaggagcagaggcgatttgtccatcactgcctgagagaatttggggggtcc
aagataggtttccagaggaaaaagatggaggctctcattatggaaaatgtcatggatttt
gtcaattttgtcgaaagtcaaggagacaaatccacactagatccacttgaaccactacgc
catagtttgggttcagctatgaacatcttggtatttggcaagtcatggagtagagacgat
aaaacttggaagtggttgcaacatttgcaggaagagggcactcagcacattggcgtagca
gggcctctcaatttcctgccatttttgaggttccatccgaaattcggtaaaacaatggat
ttcttaatcagcggcaagctggaaacgcacaaagtttataaaaaaatcatccaagaacag
gctgaatatttgaaaaatcgtgctcagggcgattctagcaccgataccaacagtattacc
aacattacccaagcttttcttgcagaaagggagcgcagaaaagatgaaccagagattctt
gaaaagttttataacgaccaacaattttatcatctcctggctgatattttcggagctggt
ctcgatactaccctcacaactctaaggtggtacctcctgtatttggcaaagaaccctgcc
atccaaagaaatatccgcatagaaatccatgacgtccttcaaaataaccttcccaccata
gaggatatcgctcatttacccttagttgaggcctccatatacgaagcccaaaggatcaga
tctgtggtgccagtaggcattccacacggtgctactgaggaggtcgaggttgacggcttt
aggatacctcaaggaagcatgatagtgccactgcaatgggcagtacatatgaacgaaaat
atgtggccagatccggagaagtttgaccctagtaggttcataaatgaggaaggaaaggta
gtgaggaacagctatttcatgccgtaccagattggaaagcgtatgtgtgttggagatgaa
ttagctaggatgatgttgtatctgtttggagcaacgattctccaaaagttttccgtggaa
ttagaggatgaacatgtagatctcataggtgtatgtggaataactctcacaccaaattct
cacaaattgatattttctaaagtttcctctaaatga

DBGET integrated database retrieval system