KEGG   Agrobacterium sp. RAC06: BSY240_2378
Entry
BSY240_2378       CDS       T04501                                 
Symbol
yidC
Name
(GenBank) membrane protein insertase
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc02024  Quorum sensing
agc03060  Protein export
agc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:agc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSY240_2378 (yidC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSY240_2378 (yidC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSY240_2378 (yidC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:agc03029]
    BSY240_2378 (yidC)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:agc02044]
    BSY240_2378 (yidC)
Mitochondrial biogenesis [BR:agc03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BSY240_2378 (yidC)
Secretion system [BR:agc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BSY240_2378 (yidC)
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP FlaX COX6C DUF2615
Other DBs
NCBI-ProteinID: AOG10169
LinkDB
Position
2445956..2447746
AA seq 596 aa
MQNNRNYFIAIALSVVIVLAWQFFYMNPRIEAQRQAQEAQIAQQQAQAEQQATSPAATVD
GSLPAGAAANPEASRDAAVARTARVEIDTQDLVGSINLTGARFDDLKLRQYRETVDPTSP
IVTLFNPAETRDGYFAELGFIAGENAGSVPGPNTVWTAPEGAKLTEATPLTLTFTNEAGL
TFTRTIAVDEHYMFTIEDQIVNNGAASASLAPYGRVTRYNKPSTPSIFVLHEGFLGVVGT
EGSLAEYDYTDVEEDAVANAKATGGWLGITDKYWATSLIPQQTLPYESRFSYFTDGQARF
QADYKNDAVSIPAGQSTSVKTLLFAGAKQVPVIDSYQESLGIPKFDLMIDWGWFYFITKP
MFHLMDYFFHLVGNFGVAILLTTIVVKLLFFPLANKQYASMANMKRVQPKLEELKTKYAD
DRMGLQQAMMALYKEEKINPVAGCWPVLLQIPVFFALYKVIYVTIEMRHAPFFGWIQDLS
APDPTSLFNLFGLLPFTPPLFLMIGVWPLIMGVTMWVQMRMNPTPPDPTQAMLFNWMPVV
FTFMLGTFPAGLVIYWAWNNTLSILQQALIMKRHGVEIELFKNIANMFRRKPAQTK
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgcagaacaaccgcaactatttcatcgcgattgccttatcggtggtgatcgtcctcgcc
tggcagttcttctatatgaacccgcgtatcgaggcccagcgtcaggctcaggaggcgcag
atcgcccagcagcaggcgcaggccgagcagcaggcgacgagccctgcagccacggttgac
ggtagcttgccagcgggtgcggccgccaatccggaagcaagccgcgatgccgccgtggcc
cggacggcccgcgtcgagatcgacacccaggatctcgtcggctccatcaatctcaccggt
gcccgattcgacgatctgaagctgcgacagtaccgcgagaccgtcgatccgacgagcccg
atcgttaccctgttcaatcctgccgaaacacgggacggctattttgccgaactcggcttt
atcgccggcgaaaatgccggttccgttccgggccccaacaccgtctggacggcacccgaa
ggcgcaaagctgaccgaggcgacacctcttacgctgaccttcaccaacgaagccggcctc
acctttacccgcacgatcgccgtcgacgaacattacatgttcaccatcgaagaccagatc
gtgaacaatggcgcagcgtccgcaagccttgcgccctatggccgcgtaacgcgctacaac
aagccgtccacgccttcgatcttcgttctgcatgaaggtttcctcggcgttgtcggcacc
gagggcagcctggcggaatacgactatacggatgtagaggaagacgccgttgccaatgcc
aaggccaccggtggctggctcggcatcacggacaagtactgggccacgtcgctcattccg
cagcagaccctgccttacgaatcgcgcttctcctacttcaccgacggtcaggcccgcttc
caggccgattacaagaacgatgccgtcagcattccggccggccagagcacctcggtcaag
accctcttgtttgccggtgccaagcaggttccggtcatcgacagctaccaggaaagcctt
ggtattccgaagtttgatctgatgatcgactggggctggttctacttcatcaccaagcca
atgttccacctgatggactacttcttccatctcgtcggtaatttcggcgtggccatcctg
ctcaccaccatcgtcgtcaagctgttgttcttcccgctcgccaacaagcagtacgcctcc
atggccaacatgaagcgtgtgcagccgaagctcgaagaactgaagaccaagtatgccgac
gaccgcatgggcctgcagcaggcgatgatggcgctctacaaggaagagaagatcaatccg
gttgccggctgctggccggtactcctgcagatcccggtcttcttcgcgctctacaaggtc
atctacgtcaccatcgaaatgcgccacgcgccgttcttcggctggatccaggatctctca
gctcccgatccgacgagcttgttcaacctgttcggtctgctgcccttcacgccgccgctc
ttcctgatgatcggcgtctggccgctcatcatgggcgtcaccatgtgggtccagatgcgc
atgaacccgacgccgccggatccgacgcaggcgatgctgttcaactggatgcccgttgtc
ttcaccttcatgctcggcacgttccccgccggcctggtgatctactgggcatggaacaac
acgctgtcgatcctgcagcaggccttgatcatgaagcgtcacggcgtggagatcgagctg
ttcaagaacatcgccaacatgttccggcggaaaccggcccagaccaagtga

DBGET integrated database retrieval system