Astur gentilis (Northern goshawk): 126036141 Help Entry 126036141         CDS       T08649                                  Name (RefSeq) thioredoxin isoform X1   KO K03671   thioredoxin Organism agen  Astur gentilis (Northern goshawk) Pathway agen04621   NOD-like receptor signaling pathway agen05132   Salmonella infection Brite KEGG Orthology (KO) [BR:agen00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     126036141  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126036141  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:agen03110]     126036141 Chaperones and folding catalysts [BR:agen03110]  Protein folding catalysts   Protein disulfide isomerase    126036141 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 AhpC-TSA Thioredoxin_7 DIM1 OST3_OST6 Glutaredoxin Thioredoxin_9 PedC-like Redoxin Motif Other DBs NCBI-GeneID:  126036141 NCBI-ProteinID:  XP_049651494 LinkDB All DBs Position Z Genome browser AA seq 112 aa AA seqDB search MPGVFEVTGSYEDFHSEFEAELKSAGEKLIVVDFSAAWCGPCKMIKPFFHSLCEKYGDVV FIEIDVDDAQDVATHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLI NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgccgggtgtgtttgaagttacgggaagttatgaagactttcactctgaatttgaggca gaactgaaatctgcaggtgagaagcttatagtagttgatttctctgctgcgtggtgtgga ccgtgcaaaatgatcaagccctttttccatagtttgtgtgagaagtatggcgatgtggtg ttcatcgaaattgatgtggatgatgctcaggatgttgctacgcactgtgatgtgaagtgc atgccaacgttccagttctacaagaatggaaagaaggtgcaggagttctctggggccaat aaagagaagctggaagagaccattaaaagtctaatctaa

DBGET integrated database retrieval system