Astur gentilis (Northern goshawk): 126040895 Help Entry 126040895         CDS       T08649                                  Name (RefSeq) C-C motif chemokine 13-like   KO K21083   C-C motif chemokine 17 Organism agen  Astur gentilis (Northern goshawk) Pathway agen04060   Cytokine-cytokine receptor interaction agen04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:agen00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     126040895  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     126040895  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:agen04052]     126040895 Cytokines and neuropeptides [BR:agen04052]  Cytokines   Chemokines    126040895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  126040895 NCBI-ProteinID:  XP_049661876 LinkDB All DBs Position 7:complement(9457626..9459302) Genome browser AA seq 87 aa AA seqDB search MLAARTVLLLVLLLTFSLHCAAAYNAPTECCFKHAQKLIRHIESFYETPSDCPLPAVVIV AASGAKVCADPKKPWVKRAMKKLRRKK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgctcgctgcaaggacagtcctgctgctcgtgctgctcctcaccttctccctgcactgt gctgcagcctacaacgcgcccaccgaatgctgcttcaagcacgcgcagaaactcatccga cacatagagagtttctatgagacacccagtgactgtcccttgcctgcagttgtgattgta gctgccagcggtgccaaggtctgtgctgaccccaagaagccctgggtgaagagagccatg aaaaagcttcgaaggaaaaaatga

DBGET integrated database retrieval system