Astur gentilis (Northern goshawk): 126041266 Help Entry 126041266         CDS       T08649                                  Name (RefSeq) protein S100-A10 isoform X1   KO K17274   protein S100-A10 Organism agen  Astur gentilis (Northern goshawk) Pathway agen04382   Cornified envelope formation agen05132   Salmonella infection Brite KEGG Orthology (KO) [BR:agen00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     126041266  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126041266  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:agen04147]     126041266 Exosome [BR:agen04147]  Exosomal proteins   Exosomal proteins of microglial cells    126041266 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 STAT_linker Motif Other DBs NCBI-GeneID:  126041266 NCBI-ProteinID:  XP_049662646 LinkDB All DBs Position 7:10547344..10550537 Genome browser AA seq 105 aa AA seqDB search MLVPQPPTMPSQMEHAMETLMFTFHKYAGDKNHLSKEDLRMLMEKEFPGFLENQRDPMAL DKIMKDLDQCRDGKVGFQGFFSLVAGLTIACNDYFVLHMKQKGRK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgttggtcccgcagccccccaccatgccatcccagatggagcacgccatggagaccctc atgttcaccttccacaagtacgcgggggacaagaaccacctcagcaaggaggacctgcgg atgctgatggagaaggagttccccggcttcttggagaaccagcgggacccgatggccctg gacaagatcatgaaggacctggaccagtgccgggacggcaaggtgggcttccagggcttc ttctcgctggtggccggcctcaccatcgcctgcaatgactacttcgtgctgcacatgaag cagaagggcaggaagtga

DBGET integrated database retrieval system