Astur gentilis (Northern goshawk): 126049642 Help Entry 126049642         CDS       T08649                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism agen  Astur gentilis (Northern goshawk) Pathway agen04137   Mitophagy - animal agen04140   Autophagy - animal agen04144   Endocytosis agen04145   Phagosome agen04148   Efferocytosis agen05132   Salmonella infection Brite KEGG Orthology (KO) [BR:agen00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     126049642    04145 Phagosome     126049642    04140 Autophagy - animal     126049642    04137 Mitophagy - animal     126049642    04148 Efferocytosis     126049642  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126049642  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:agen04131]     126049642   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:agen04147]     126049642    04031 GTP-binding proteins [BR:agen04031]     126049642 Membrane trafficking [BR:agen04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     126049642 Exosome [BR:agen04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126049642   Exosomal proteins of other body fluids (saliva and urine)    126049642   Exosomal proteins of colorectal cancer cells    126049642   Exosomal proteins of bladder cancer cells    126049642 GTP-binding proteins [BR:agen04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     126049642 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_24 AAA_16 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  126049642 NCBI-ProteinID:  XP_049682315 LinkDB All DBs Position 23:complement(11347248..11367311) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRVKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtggga aagacatcgcttatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggtgcagacttcctgacaaaagaggtcatggtggatgacaggctagtgacaatgcag atatgggatacagcaggacaagaacgatttcagtctctgggagttgccttctacagggga gcagactgctgtgtgctggtgtttgatgtcacggcccccaacacattcaaaaccctagac agctggagggacgaattcctcattcaggccagtccaagggatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcgcaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gagctttacaatgaattccccgaacccatcaaactagacaagaatgaccgagtgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system