Astur gentilis (Northern goshawk): 126049889 Help Entry 126049889         CDS       T08649                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism agen  Astur gentilis (Northern goshawk) Pathway agen04081   Hormone signaling agen04144   Endocytosis agen04150   mTOR signaling pathway agen04270   Vascular smooth muscle contraction agen04310   Wnt signaling pathway agen04350   TGF-beta signaling pathway agen04510   Focal adhesion agen04520   Adherens junction agen04530   Tight junction agen04621   NOD-like receptor signaling pathway agen04625   C-type lectin receptor signaling pathway agen04810   Regulation of actin cytoskeleton agen05100   Bacterial invasion of epithelial cells agen05132   Salmonella infection Brite KEGG Orthology (KO) [BR:agen00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     126049889    04350 TGF-beta signaling pathway     126049889    04150 mTOR signaling pathway     126049889   09133 Signaling molecules and interaction    04081 Hormone signaling     126049889  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     126049889   09144 Cellular community - eukaryotes    04510 Focal adhesion     126049889    04520 Adherens junction     126049889    04530 Tight junction     126049889   09142 Cell motility    04810 Regulation of actin cytoskeleton     126049889  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     126049889    04625 C-type lectin receptor signaling pathway     126049889   09153 Circulatory system    04270 Vascular smooth muscle contraction     126049889  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126049889    05100 Bacterial invasion of epithelial cells     126049889  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:agen04131]     126049889   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:agen04147]     126049889    04031 GTP-binding proteins [BR:agen04031]     126049889 Membrane trafficking [BR:agen04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     126049889 Exosome [BR:agen04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126049889   Exosomal proteins of other body fluids (saliva and urine)    126049889   Exosomal proteins of colorectal cancer cells    126049889   Exosomal proteins of bladder cancer cells    126049889 GTP-binding proteins [BR:agen04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     126049889 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  126049889 NCBI-ProteinID:  XP_049682968 LinkDB All DBs Position 23:8454150..8480525 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattatgtagcagatatcgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactatgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccagaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaagaaggaagagatatggcaaaccgcattggtgcatttgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttgtcttataa

DBGET integrated database retrieval system