Astur gentilis (Northern goshawk): 126053310 Help Entry 126053310         CDS       T08649                                  Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism agen  Astur gentilis (Northern goshawk) Pathway agen04814   Motor proteins agen05132   Salmonella infection Brite KEGG Orthology (KO) [BR:agen00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     126053310  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     126053310  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:agen03037]     126053310    04812 Cytoskeleton proteins [BR:agen04812]     126053310 Cilium and associated proteins [BR:agen03037]  Motile cilia and associated proteins   Dynein arm    126053310 Cytoskeleton proteins [BR:agen04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      126053310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  126053310 NCBI-ProteinID:  XP_049691322 LinkDB All DBs Position 32:13058605..13066395 Genome browser AA seq 116 aa AA seqDB search MEEFHPHNDEMIFNADEAHNIVKECIESVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGK TYKYIVTCAVMQKSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtttcacccccacaacgacgagatgatcttcaatgccgatgaggcccacaac atagttaaggagtgcatagaaagtgttttaggcaaggcagattataatcacaacaaagtc aaccagtggactgctgctatagtagaacagtcgctgacacatctggtaaaactcggaaaa acatataagtacattgtaacctgtgcagtgatgcagaagagtggagctggtcttcacaca gcaagctcatgcttctgggatactacaactgatggaacctgcacagtgagatgggaaaac cgaacaatgaactgcattgtcaatgtgtttgctgttgctattatcctgtag

DBGET integrated database retrieval system