Agromyces protaetiae: ET445_04370 Help Entry ET445_04370       CDS       T05835                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism agf  Agromyces protaetiae Brite KEGG Orthology (KO) [BR:agf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:agf03032]     ET445_04370    03036 Chromosome and associated proteins [BR:agf03036]     ET445_04370    03400 DNA repair and recombination proteins [BR:agf03400]     ET445_04370 DNA replication proteins [BR:agf03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ET445_04370 Chromosome and associated proteins [BR:agf03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ET445_04370 DNA repair and recombination proteins [BR:agf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ET445_04370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG bHLH_STRA8 PSF3_N Motif Other DBs NCBI-ProteinID:  QAY72694 UniProt:  A0A4P6FA69 LinkDB All DBs Position 936552..936839 Genome browser AA seq 95 aa AA seqDB search MADKSLNKTELVAKIAASTNQSQATVDAVLGGLFDALAEAVGSDTKVSIPGWLAVERTSR AARTGRNPQTGETIQIPAGHSVKVSAGSKLKAAAK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctgacaagtcgctgaacaagaccgagctcgtcgcgaagatcgccgcgtcgacgaac cagagccaggccacggtcgacgccgtgctcggcggtctcttcgacgcgctcgccgaggcc gtcggctccgacaccaaggtctcgatccccggctggctcgccgtcgagcgcacgtcgcgc gctgcccgcacgggccgcaacccgcagaccggtgagaccatccagatcccggccggtcac tcggtcaaggtctcggccggctcgaagctcaaggctgccgcgaagtaa

DBGET integrated database retrieval system