Arachidicoccus ginsenosidivorans: FSB73_04570 Help Entry FSB73_04570       CDS       T06150                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism agi  Arachidicoccus ginsenosidivorans Pathway agi00190   Oxidative phosphorylation agi01100   Metabolic pathways Module agi_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:agi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FSB73_04570 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:agi00194]     FSB73_04570 (atpE) Photosynthesis proteins [BR:agi00194]  Photosystem and electron transport system   F-type ATPase [OT]    FSB73_04570 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF3999 Motif Other DBs NCBI-ProteinID:  QEC71062 UniProt:  A0A5B8VJD3 LinkDB All DBs Position complement(1141913..1142164) Genome browser AA seq 83 aa AA seqDB search MSVLNTVMAEAAGMAKGLGAIGAGVAALGAGVGIGQIGKGAVEAIARQPEASGDIRANMI LAAALVEGVAFLGVIAGILAIVL NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtcagtattaaacactgtaatggcagaagccgccggaatggcaaaaggcctcggagct attggtgcaggcgttgccgcccttggagcaggggttggtatcggacaaatcggtaaaggt gctgtagaagctatcgctcgtcagccagaagcatctggcgatattcgtgcgaacatgatc ttagcagctgccctggttgaaggtgttgccttcctgggtgtaattgccggtatccttgca atcgtactttaa

DBGET integrated database retrieval system