Aphidius gifuensis: 122849148 Help Entry 122849148         CDS       T07796                                  Name (RefSeq) CD63 antigen-like   KO K06497   CD63 antigen Organism agif  Aphidius gifuensis Pathway agif03272   Virion - Hepatitis viruses agif04142   Lysosome Brite KEGG Orthology (KO) [BR:agif00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     122849148  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome     122849148  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:agif04147]     122849148    04090 CD molecules [BR:agif04090]     122849148 Exosome [BR:agif04147]  Exosomal proteins   Proteins found in most exosomes    122849148 CD molecules [BR:agif04090]  Proteins   122849148 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tetraspanin Motif Other DBs NCBI-GeneID:  122849148 NCBI-ProteinID:  XP_044003699 LinkDB All DBs Position LG2:12154566..12155428 Genome browser AA seq 122 aa AA seqDB search MELSASIWIWTNKDNMIDIGEIMSQYEENQEARLTLDAMQTSLQCCGSTGPSDWVKYRNH VINDISAPHSCCFSTKNNENNTITCSGYYQKGCSGPLKTFIHENAIKIITSAIIIVSIQV KY NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggaattatcagcttcaatatggatttggacaaataaagataatatgatagacattgga gaaattatgtcacaatatgaagaaaatcaagaagctcgattgacccttgatgcaatgcaa acatcgcttcaatgctgcggatctactggcccatcagactgggtcaaatatcgtaatcat gtgattaatgatatttcagcaccacattcatgctgtttttcaacaaaaaacaatgaaaat aatacaattacatgctctggttattatcaaaaaggttgtagtggtccattaaaaacattt atacatgaaaacgcaataaaaataataacatcagcaataattattgtgtcaattcaggta aaatattaa

DBGET integrated database retrieval system