Aggregatibacter sp. oral taxon 513: J5A60_00915 Help Entry J5A60_00915       CDS       T08731                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism agj  Aggregatibacter sp. oral taxon 513 Pathway agj01100   Metabolic pathways agj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J5A60_00915    00074 Mycolic acid biosynthesis     J5A60_00915   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J5A60_00915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7095 Motif Other DBs NCBI-ProteinID:  QUC06045 LinkDB All DBs Position 164248..164511 Genome browser AA seq 87 aa AA seqDB search MELEQQIKQLIIDSLALEDISVEDIENDTALFGDDGLGLDSVDALELGLAVQKTFHLQLD SEQTQVRNHFESVATLASFIRSQKGEA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaactggaacagcaaattaaacaattaattattgatagtttggcattagaagatatc agtgttgaagatattgaaaatgacaccgcactttttggtgatgatggtttagggttggac tctgttgatgcgcttgaactgggcttggcagtgcaaaaaacatttcatttgcaactggat agtgaacaaacccaagtacgtaatcactttgaaagtgtagcgaccttggcaagttttatt cgtagtcaaaaaggtgaggcgtaa

DBGET integrated database retrieval system