Aggregatibacter sp. oral taxon 513: J5A60_00920 Help Entry J5A60_00920       CDS       T08731                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism agj  Aggregatibacter sp. oral taxon 513 Pathway agj01100   Metabolic pathways agj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J5A60_00920    00074 Mycolic acid biosynthesis     J5A60_00920   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J5A60_00920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 DUF2482 RE_EcoO109I Motif Other DBs NCBI-ProteinID:  QUC06046 LinkDB All DBs Position 164513..164764 Genome browser AA seq 83 aa AA seqDB search MTEQEIRDLLTEALESLFEIEPERIKPETNLYEDLEIDSIDAIDLIDHIKRKTGHKLQAE DFRNVRTVDDVVKAVLKISQSAQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactgaacaagaaattcgagatttattgactgaggcgcttgagtctttatttgaaatc gaaccggaaagaattaagccggaaaccaatctgtatgaagatttagaaattgatagcatt gatgcgattgatttgatcgatcacattaaacgtaaaacaggccacaaattgcaagcggaa gattttcgtaatgttcgtaccgtagatgatgtggtcaaagccgtactaaaaatcagccag agcgctcaataa

DBGET integrated database retrieval system