Aggregatibacter sp. oral taxon 513: J5A60_01670 Help Entry J5A60_01670       CDS       T08731                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism agj  Aggregatibacter sp. oral taxon 513 Pathway agj01100   Metabolic pathways agj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J5A60_01670 (acpP)    00074 Mycolic acid biosynthesis     J5A60_01670 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J5A60_01670 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 DUF1896 Motif Other DBs NCBI-ProteinID:  QUC06191 LinkDB All DBs Position 311056..311286 Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVEQLGVKEEDVKSEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcattgaagaacgcgtaaaaaaaatcatcgttgaacaattaggcgtgaaagaagaa gatgtaaaatctgaagcgtctttcgttgaagatttaggtgcggattctttagatactgtt gaattagttatggctttagaagaagaattcgatatcgaaattccagatgaagaagctgaa aaaatcacaacagttcaatcagcaattgattacgttcaaaacaatcaataa

DBGET integrated database retrieval system