Aggregatibacter sp. oral taxon 513: J5A60_03535 Help Entry J5A60_03535       CDS       T08731                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism agj  Aggregatibacter sp. oral taxon 513 Pathway agj02024   Quorum sensing agj03018   RNA degradation Brite KEGG Orthology (KO) [BR:agj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     J5A60_03535 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     J5A60_03535 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:agj03019]     J5A60_03535 (hfq)    03036 Chromosome and associated proteins [BR:agj03036]     J5A60_03535 (hfq) Messenger RNA biogenesis [BR:agj03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      J5A60_03535 (hfq) Chromosome and associated proteins [BR:agj03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     J5A60_03535 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Gag_p24_C LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QUC06528 LinkDB All DBs Position complement(719600..719893) Genome browser AA seq 97 aa AA seqDB search MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS TVVPARSVAHHNANQQQQHQVQQETPSVENNIDAQAE NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaggacaatctctacaagatccttacttgaatgcattacgtcgtgaacgcatt cccgtttcaatctatttagtaaacggtatcaaattacaagggcaaatcgaatcgtttgac caattcgtgattttattgaaaaacacggtaaatcaaatggtttataaacacgcaatttca actgttgttccggcacgttctgtcgcacatcacaatgcgaaccaacagcaacaacaccaa gtacaacaggaaactccttctgtagaaaacaatattgatgctcaagcagaataa

DBGET integrated database retrieval system