Actinacidiphila glaucinigra: OIE69_27055 Help Entry OIE69_27055       CDS       T09685                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism agla  Actinacidiphila glaucinigra Pathway agla00998   Biosynthesis of various antibiotics agla01100   Metabolic pathways agla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agla00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OIE69_27055    00074 Mycolic acid biosynthesis     OIE69_27055   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OIE69_27055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WSD62279 LinkDB All DBs Position complement(6026162..6026407) Genome browser AA seq 81 aa AA seqDB search MATQEEIVEGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFEVKIPD DDVKQLKTVGDAVDYILKAQG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggccacccaggaagagatcgtcgagggtctcgcggagatcgtgaacgagatcgccggc atcccgaccgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgactcg ctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgaggtcaagatcccggac gacgacgtcaagcagctgaagaccgtcggcgacgccgtcgactacatcctcaaggctcag ggctga

DBGET integrated database retrieval system