Alnus glutinosa (common alder): 133851720 Help Entry 133851720         CDS       T10577                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism aglu  Alnus glutinosa (common alder) Pathway aglu03083   Polycomb repressive complex aglu04120   Ubiquitin mediated proteolysis aglu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aglu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     133851720    04120 Ubiquitin mediated proteolysis     133851720   09126 Chromosome    03083 Polycomb repressive complex     133851720  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aglu04131]     133851720    04121 Ubiquitin system [BR:aglu04121]     133851720    03036 Chromosome and associated proteins [BR:aglu03036]     133851720 Membrane trafficking [BR:aglu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     133851720 Ubiquitin system [BR:aglu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      133851720    Cul7 complex      133851720 Chromosome and associated proteins [BR:aglu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      133851720   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      133851720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 DUF6324 Motif Other DBs NCBI-GeneID:  133851720 NCBI-ProteinID:  XP_062144257 LinkDB All DBs Position 12:26110821..26112554 Genome browser AA seq 155 aa AA seqDB search MSLSKKITLKSSDGEAFEADEAVALKLPTIKKMIEDDCAENGIPLPNLTSKILAKVIVYS KKHVEAANPDDRTSEYHLKAWDAEFVEVDQDTLFDLILAANYLNIKSLQDLTCQTLAEMV KGKTPEEIRKMFNIKNDFTPEEAEEVHRETRWLFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcattgtcgaagaagatcaccctaaagagctcggatggcgaggccttcgaggctgat gaggctgtggcgctcaagttgccgacgatcaagaagatgatcgaggacgattgtgccgaa aacggaatccccctcccgaacttgacgagcaagatcttggccaaggtaattgtgtactcc aaaaagcacgtcgaggcggcgaaccccgacgaccgcacctccgaataccacctcaaggct tgggacgccgagttcgtcgaggttgaccaggacactctattcgacctcattttggccgca aactatttgaacatcaagagtcttcaggatctgacatgccaaactctagcagagatggtc aaggggaagactccagaggagattcgcaagatgtttaacatcaagaatgacttcaccccg gaggaagcggaagaggttcatcgggagacccggtggttatttgaatga

DBGET integrated database retrieval system