Alnus glutinosa (common alder): 133863363 Help Entry 133863363         CDS       T10577                                  Name (RefSeq) ras-related protein RABF1-like   KO K07887   Ras-related protein Rab-5A Organism aglu  Alnus glutinosa (common alder) Pathway aglu04144   Endocytosis aglu04145   Phagosome aglu04148   Efferocytosis Brite KEGG Orthology (KO) [BR:aglu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     133863363    04145 Phagosome     133863363    04148 Efferocytosis     133863363  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aglu04131]     133863363   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aglu04147]     133863363    04031 GTP-binding proteins [BR:aglu04031]     133863363 Membrane trafficking [BR:aglu04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     133863363  Endosome - Lysosome transport     133863363 Exosome [BR:aglu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133863363   Exosomal proteins of other body fluids (saliva and urine)    133863363   Exosomal proteins of colorectal cancer cells    133863363   Exosomal proteins of bladder cancer cells    133863363 GTP-binding proteins [BR:aglu04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     133863363 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras RsgA_GTPase Motif Other DBs NCBI-GeneID:  133863363 NCBI-ProteinID:  XP_062155288 LinkDB All DBs Position 3:complement(31928953..31930109) Genome browser AA seq 125 aa AA seqDB search MVGLSTNESLFYVGYSHLPNMGPGCYRFDEDSIGNNNIKVVPNGLAFFITKFINELQKHG NPDIVMALVGNKADLQEKREVPVQDGIDYAEKNGMFFIETSAKTADNINQLFEEIAKRLP RPPAS NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggttggacttagcactaatgagtctttattctatgtgggctactctcatcttcccaat atgggaccgggttgttacagatttgacgaggactcaattggaaataacaatataaaagtt gtacctaatggcttggctttttttatcacaaagttcattaatgaattgcaaaaacatgga aatcctgatatagtcatggccttagttggtaacaaagctgatcttcaggagaagcgggaa gtaccagttcaggatggcattgactatgcggagaagaatggaatgttttttatcgagaca tctgcaaagacggcagataatataaatcagctgtttgaggaaattgccaagcggctaccc cgccctcccgcttcatga

DBGET integrated database retrieval system