Alnus glutinosa (common alder): 133874867 Help Entry 133874867         CDS       T10577                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism aglu  Alnus glutinosa (common alder) Pathway aglu04145   Phagosome aglu04148   Efferocytosis aglu04517   IgSF CAM signaling aglu04518   Integrin signaling aglu04620   Toll-like receptor signaling pathway aglu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aglu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     133874867    04518 Integrin signaling     133874867  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     133874867    04148 Efferocytosis     133874867  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133874867  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     133874867  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aglu04131]     133874867   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aglu04147]     133874867    04031 GTP-binding proteins [BR:aglu04031]     133874867 Membrane trafficking [BR:aglu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     133874867  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     133874867   Macropinocytosis    Ras GTPases     133874867  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     133874867 Exosome [BR:aglu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133874867   Exosomal proteins of other body fluids (saliva and urine)    133874867   Exosomal proteins of colorectal cancer cells    133874867   Exosomal proteins of bladder cancer cells    133874867 GTP-binding proteins [BR:aglu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     133874867 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU B12-binding Gtr1_RagA Motif Other DBs NCBI-GeneID:  133874867 NCBI-ProteinID:  XP_062168738 LinkDB All DBs Position 8:complement(4761066..4766152) Genome browser AA seq 211 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGIPVVLVGT KLDLREDKYYLADHPGLVPVTTAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAAIKVVI RPVQKQKEKKKKPHRGCLSNVLRGRSFVCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcttcaagtgcttcgaggttcatcaagtgtgtgacagtgggagatggggctgtgggg aagacctgcatgcttatttgctacacaagtaacaaattccccactgattacatacccaca gtttttgataacttcagtgcaaacgtggtagttgaaggcaccactgtcaacttaggcctc tgggacacggctgggcaagaggattacaatagattaaggccattgagctacaggggggca gatgtctttgtcttagctttctcattagttagtcgtgcaagctatgaaaacgtactgaaa aagtggatccctgaacttcagcattatgcccctggaattcctgtggtgctggttggcacc aaattggatcttcgtgaggataagtactatttggctgatcatcctggattggtgcctgtg acaactgcacagggcgaggaactccgtaaacagattggtgctgcatattatatagagtgc agctcaaaaactcagcagaatgtgaaagcagtttttgatgctgcaatcaaggtggttatt aggccggtacagaagcagaaagagaagaagaaaaagccacatcgtggatgcctatcaaat gtccttcgtgggaggagtttcgtgtgtctcaaatga

DBGET integrated database retrieval system