Alnus glutinosa (common alder): 133877109 Help Entry 133877109         CDS       T10577                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism aglu  Alnus glutinosa (common alder) Pathway aglu04016   MAPK signaling pathway - plant aglu04070   Phosphatidylinositol signaling system aglu04075   Plant hormone signal transduction aglu04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:aglu00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     133877109    04070 Phosphatidylinositol signaling system     133877109    04075 Plant hormone signal transduction     133877109  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     133877109  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aglu01009]     133877109   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aglu04131]     133877109    03036 Chromosome and associated proteins [BR:aglu03036]     133877109   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aglu04147]     133877109 Protein phosphatases and associated proteins [BR:aglu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      133877109 Membrane trafficking [BR:aglu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     133877109 Chromosome and associated proteins [BR:aglu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      133877109 Exosome [BR:aglu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    133877109 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  133877109 NCBI-ProteinID:  XP_062171334 LinkDB All DBs Position 9:12559854..12563018 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctcaccgatgaccagatctccgagttcaaggaggccttcagcctattc gacaaggacggcgatggctgtatcactaccaaggagcttgggaccgtaatgcgatcactg gggcagaacccaactgaagcggagctacaggacatgataaatgaggttgatgctgatggg aatggtaccattgacttcccagagttccttaacctgatggcccgtaagatgaaggacact gattcggaggaggagctcaaggaggcttttcgggtgtttgacaaggaccagaatggcttc atttctgcagctgagctccgccatgttatgacaaatcttggtgagaagctgaccgatgag gaagttgatgagatgattcgggaggctgatgtggatggagatggacagatcaactatgag gagtttgtcaaagtcatgatggccaagtga

DBGET integrated database retrieval system