Alnus glutinosa (common alder): 133877498 Help Entry 133877498         CDS       T10577                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism aglu  Alnus glutinosa (common alder) Brite KEGG Orthology (KO) [BR:aglu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:aglu03041]     133877498   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aglu04052]     133877498 Spliceosome [BR:aglu03041]  Complex B   Other components    Complex B specific factors     133877498 Cytokines and neuropeptides [BR:aglu04052]  Neuropeptides   Unclassified    133877498 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL HCBP_related Crinkler Motif Other DBs NCBI-GeneID:  133877498 NCBI-ProteinID:  XP_062171811 LinkDB All DBs Position 9:complement(17455264..17459350) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRSDKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtactgaacgatcggctgggcaagaaggtgcgtgtgaagtgcaacgag gatgacaccatcggcgacctgaagaagctggtggcggcccagacgggcacccgatcggac aagatccgcatccagaagtggtacaacatctacaaggaccacatcaccctcaaggactac gagatccacgacggcatgggcctcgagctctactacaactag

DBGET integrated database retrieval system