Alnus glutinosa (common alder): 133877953 Help Entry 133877953         CDS       T10577                                  Name (RefSeq) sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism aglu  Alnus glutinosa (common alder) Pathway aglu03018   RNA degradation aglu03040   Spliceosome Brite KEGG Orthology (KO) [BR:aglu00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     133877953   09123 Folding, sorting and degradation    03018 RNA degradation     133877953  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aglu03019]     133877953    03041 Spliceosome [BR:aglu03041]     133877953 Messenger RNA biogenesis [BR:aglu03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      133877953   mRNA degradation factors    5'-3' decay     Lsm complex      133877953 Spliceosome [BR:aglu03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     133877953 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF150_C Hfq Motif Other DBs NCBI-GeneID:  133877953 NCBI-ProteinID:  XP_062172399 LinkDB All DBs Position 9:2529876..2536506 Genome browser AA seq 99 aa AA seqDB search MSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAIEFLRDPDDPLKT TDQTRRLGLIVCRGTAVMLVSPTDGTDEIANPFLQADGV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtcaggacgcaaagaaacggttttggatcttgccaaatttgttgataagggtgtccaa gtcaagcttactggtggacgacaagtcacagggaccttgaaaggttatgaccagttgctg aacctcgtccttgatgaagccatagaattcttgagagatccggatgaccctctgaagacg accgatcagactagacgccttggcctaatagtatgccggggtactgctgtgatgcttgtt tccccaactgatggtactgatgagattgcaaaccccttccttcaggcagatggggtgtag

DBGET integrated database retrieval system