Anoxybacillus gonensis: AFK25_05520 Help Entry AFK25_05520       CDS       T04000                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism agn  Anoxybacillus gonensis Pathway agn01100   Metabolic pathways agn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AFK25_05520    00074 Mycolic acid biosynthesis     AFK25_05520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AFK25_05520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  AKS38015 UniProt:  A0AAW7TH03 LinkDB All DBs Position 1032445..1032681 Genome browser AA seq 78 aa AA seqDB search MADVLERVTKIIVDRLGVEESQVTLESSFKEDLGADSLDVVELVMELEDEFDMEISDEEA EKIVTVGDAVNYIKSRLS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcagacgtattagagcgtgtaacgaaaatcatcgtagatcgccttggtgtcgaggag tcacaagtgacgcttgaatcttcattcaaagaagatttaggagcagattcgcttgatgtc gttgagcttgttatggagttagaagacgaatttgatatggaaatttcagatgaagaggcg gagaaaattgttactgtcggtgacgcagtaaactacataaaaagccgtctatcataa

DBGET integrated database retrieval system