Eremothecium gossypii: AGOS_ACR111C Help Entry AGOS_ACR111C      CDS       T00167                                  Name (RefSeq) ACR111Cp   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism ago  Eremothecium gossypii Pathway ago03020   RNA polymerase ago03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ago00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     AGOS_ACR111C   09124 Replication and repair    03420 Nucleotide excision repair     AGOS_ACR111C  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ago03021]     AGOS_ACR111C    03400 DNA repair and recombination proteins [BR:ago03400]     AGOS_ACR111C Transcription machinery [BR:ago03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      AGOS_ACR111C   RNA polymerase III system    RNA polymerase III      AGOS_ACR111C   RNA polymerase I system    RNA polymerase I      AGOS_ACR111C DNA repair and recombination proteins [BR:ago03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       AGOS_ACR111C BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb8 Motif Other DBs NCBI-GeneID:  4619644 NCBI-ProteinID:  NP_983513 UniProt:  Q75C08 LinkDB All DBs Position III:complement(548895..549329) Genome browser AA seq 144 aa AA seqDB search MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA TTLNLDGTEDSHGSWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYSFGGLL MRLEGNYRLLSNFKQENVYLLCRR NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgtcctcgactctctttgacgacatcttcacgatccaggaagtggaccagggacggtac aataaggtatcgcggattgaggccatctccacgtcgcaggacacgtgcaagctgacgctg gatgtgaacacagagctcttcccgctgcaaccacaacagcagctaacggtgatgctggcg acgacactcaacctcgacggaacggaggacagccacgggtcctggcggcctccggcccct ggggcgcggtccctggccgacgacttcgactacgtgacgtatgggacggcatacaagttc gaggaggccaacgggaacaaggatatgctggcggtgtactactcattcggggggttgctg atgcggctggagggcaactaccggctcttgagcaacttcaagcaggagaacgtgtacctg ctgtgccgccgctga

DBGET integrated database retrieval system