Eremothecium gossypii: AGOS_AGR157C Help Entry AGOS_AGR157C      CDS       T00167                                  Name (RefSeq) AGR157Cp   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism ago  Eremothecium gossypii Pathway ago03060   Protein export ago04141   Protein processing in endoplasmic reticulum ago04145   Phagosome Brite KEGG Orthology (KO) [BR:ago00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AGOS_AGR157C    04141 Protein processing in endoplasmic reticulum     AGOS_AGR157C  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     AGOS_AGR157C  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ago04131]     AGOS_AGR157C   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ago02044]     AGOS_AGR157C Membrane trafficking [BR:ago04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     AGOS_AGR157C Secretion system [BR:ago02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    AGOS_AGR157C BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  4623125 NCBI-ProteinID:  NP_986823 UniProt:  Q74ZP1 LinkDB All DBs Position VII:complement(1360632..1360844) Genome browser AA seq 70 aa AA seqDB search MAKNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKL IHIPIRHLIV NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggccaagaacaacaacaacctcgagaagctttccgacgctccactggagtttttcaag gacggcacggccttcctgtccaagtgcaacaagcccaaccagcgcgagttcctgcagatc atccgcgctgtgggtatcggcttcctggccgtgggcgtgatcggctacgccataaagctc atccacatcccaatcagacacctcattgtatag

DBGET integrated database retrieval system