Agarivorans sp. B2Z047: LQZ07_05055 Help Entry LQZ07_05055       CDS       T08685                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism agq  Agarivorans sp. B2Z047 Brite KEGG Orthology (KO) [BR:agq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:agq03036]     LQZ07_05055 (ftsL) Chromosome and associated proteins [BR:agq03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LQZ07_05055 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC 7tm_1 DUF5993 Motif Other DBs NCBI-ProteinID:  UQN43837 LinkDB All DBs Position 1078060..1078377 Genome browser AA seq 105 aa AA seqDB search MDEVSRQPNLLRAISKDVWRNKQHFLLLVAAVVSAFCVVWTTHHTRMFVEQRESLMMSRD ALNVEWRHLLIEQNALAEHSRVESIAKKRLDMHRPKIEEQVVITN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggacgaggttagccgccagcccaatttattgcgggcgatttcgaaagatgtgtggcgt aacaagcagcactttttgttgttagtggctgcggtggtttcggccttttgtgtggtgtgg acaactcaccacaccagaatgtttgttgaacaacgagagtcattgatgatgagccgggat gcactcaatgttgaatggcgacatttattaatagaacaaaacgcgctggctgaacacagc cgcgtagagagcatagctaaaaagcgtttagatatgcaccgacccaaaattgaagaacaa gtggtaatcacaaactaa

DBGET integrated database retrieval system