KEGG   Agarivorans sp. B2Z047: LQZ07_23745
Entry
LQZ07_23745       CDS       T08685                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
agq  Agarivorans sp. B2Z047
Pathway
agq00770  Pantothenate and CoA biosynthesis
agq01100  Metabolic pathways
agq01240  Biosynthesis of cofactors
Module
agq_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:agq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LQZ07_23745 (coaD)
Enzymes [BR:agq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     LQZ07_23745 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig ATP-sulfurylase
Other DBs
NCBI-ProteinID: UQN42750
LinkDB
Position
5131809..5132291
AA seq 160 aa
MTTRVIYPGTFDPVTNGHSDLIQRAARMFDTVIVAVAASPSKQPLFSLEERVKLLEQTIS
ANTNIEVIGFTGLLVDLAKQQNANVLLRGLRTGSDFEYEMQLADMNRQLDPNLESVFLTP
GEGVSFISSTLIKEVAKHGGEIERFVAPHVAKSVSKKLAK
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacaactcgggtaatttatcctggcacctttgatccagtgaccaacggccatagcgat
ttaatccaacgcgcggcgcgtatgtttgacacagtaattgtggcggttgccgccagcccc
agtaaacaacctctgtttagcttagaagaaagggttaagttgctggaacaaacgattagt
gccaataccaatatagaagtgattggttttacaggcttattggtagatttagccaaacaa
caaaatgccaacgtattgttgcgcggcttgcgcaccggttctgattttgaatatgagatg
cagctggccgatatgaaccgccaactggatcccaacttagaaagcgtgtttcttacacca
ggcgagggggtgagttttatttcctccaccctgattaaagaagtggccaaacatggcggc
gaaatagaacgctttgttgcgccgcatgttgctaaatccgtcagtaagaaactcgctaaa
taa

DBGET integrated database retrieval system