KEGG   Actinomadura graeca: AGRA3207_000072
Entry
AGRA3207_000072   CDS       T07938                                 
Name
(GenBank) AraC family transcriptional regulator
Organism
agra  Actinomadura graeca
SSDB
Motif
Pfam: Cupin_6 HTH_18 HTH_AraC TetR_N HTH_AsnC-type CBP_BcsQ
Other DBs
NCBI-ProteinID: QXJ19520
UniProt: A0ABX8QLJ8
LinkDB
Position
complement(80926..81867)
AA seq 313 aa
MDALTDLLDGPRARGAFMLRSSLNPPWSMRIQDEAPLTLVAMVRDEAWVIPDSGPPERVR
PGDVMIIRGPEPYTVASGPRIEPQIVIVPGQRCTTPDGTSLSEAMDLGVRAWGNDPDGSA
VMLTGTYQMRGAVTQRLLAALPALAVVRGGTWRSPLVGLLGEEIGKDEPGQEVVLDRLLD
LLLIAALRAWFSRPQAEKPGWYRAHGDAVVGPALRLLHDDLAHPWTVSGLAARVGVSRAA
LAQRFGKLIGEPPMAYLTGVRLAQAADLLRESDATLEAVARQVGYGNAFALSAAFKRERG
ISPQEYRAGAATA
NT seq 942 nt   +upstreamnt  +downstreamnt
atggacgccctgaccgatctgctcgacggcccgcgcgcgcggggggcgttcatgctgcgc
tcctcgctcaacccgccgtggtccatgcggatccaggacgaggcgccgctgacgctggtc
gcgatggtccgcgatgaggcgtgggtgatccccgacagcggcccgcccgagcgcgtccgg
cccggcgacgtgatgatcatccgcgggccggagccgtacacggtcgccagtgggccccgg
atcgagccgcagatcgtgatcgtccccggccagcgctgcacgacaccggacggcacgagc
ctgtcggaggcgatggacctcggggtgcgggcctggggcaacgacccggacggctccgcg
gtcatgctgaccggcacctaccagatgcgcggcgcggtcacgcagcggctcctcgcggcg
ctgcccgcgctggcggtcgtccgcggcggcacctggaggtcgccgctggtcgggctgctc
ggcgaggagatcggcaaggacgagccgggccaggaggtcgtcctcgaccggctgctcgac
ctgctgctcatcgcggcgctgcgcgcgtggttctcccgtccgcaggcggagaagcccggc
tggtaccgggcgcacggcgacgcggtggtgggccccgcgctgcggctgctgcacgacgac
ctggcgcacccgtggacggtctccggcctcgccgcgagggtcggcgtctcccgggccgcg
ctcgcgcagcggttcgggaagctgatcggggagccgccgatggcgtacctgacgggcgtc
cgcctcgcccaggccgccgacctcctccgcgagagcgacgcgacgctggaggcggtggcg
cggcaggtcggctacggcaacgcgttcgcgctcagcgcggccttcaagcgcgagcgcggg
atcagcccccaggagtaccgggcgggggccgccaccgcctag

DBGET integrated database retrieval system