Actinomadura graeca: AGRA3207_002279 Help Entry AGRA3207_002279   CDS       T07938                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism agra  Actinomadura graeca Pathway agra00998   Biosynthesis of various antibiotics agra01100   Metabolic pathways agra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agra00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AGRA3207_002279    00074 Mycolic acid biosynthesis     AGRA3207_002279   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AGRA3207_002279 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QXJ21427 UniProt:  A0ABX8QUL5 LinkDB All DBs Position 2537309..2537575 Genome browser AA seq 88 aa AA seqDB search MRLFPQRSARRRVVALLAEVRPESASRAAAGGARLGQDLGMDSLATAALAVRLAEEFEID LVALAGRRAEIETIDDLVAVVEELADAG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaggctgttcccgcaacgaagcgcgcgccgcagggtggtcgcgctgctggcggaggtc cgcccggagtcggcgtcccgcgcggcggccggcggggcgcggctcggccaggacctcggg atggactcgctcgcgacggcggcgctggccgtccgcctcgccgaggagttcgagatcgac ctggtcgccctcgccgggcggcgcgccgagatcgagacgatcgacgacctggtcgcggtg gtcgaggagctggccgatgccggctga

DBGET integrated database retrieval system