Actinomadura graeca: AGRA3207_002373 Help Entry AGRA3207_002373   CDS       T07938                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism agra  Actinomadura graeca Pathway agra00998   Biosynthesis of various antibiotics agra01100   Metabolic pathways agra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agra00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AGRA3207_002373    00074 Mycolic acid biosynthesis     AGRA3207_002373   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AGRA3207_002373 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ClpB_D2-small Motif Other DBs NCBI-ProteinID:  QXJ21514 UniProt:  A0ABX8QTK1 LinkDB All DBs Position complement(2716444..2716692) Genome browser AA seq 82 aa AA seqDB search MPVEKITDEDVLELLVAVGLDKAAGAESLARSFEELDLDSLARMEIATRIQDRYDIDVEE DLTAEQTPEGLRRMVTERRLAV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcctgtagagaagatcaccgacgaggacgtcctggagctgctggtcgccgtgggcctg gacaaggccgccggcgccgagtccctcgcccgctccttcgaggagctcgacctggactcc ctggcccggatggagatcgccacccggatccaggaccgctacgacatcgacgtcgaagag gacctcaccgccgagcagacccccgaggggctgaggcgcatggtcaccgaacgccggctc gccgtctga

DBGET integrated database retrieval system