KEGG   Actinomadura graeca: AGRA3207_005106
Entry
AGRA3207_005106   CDS       T07938                                 
Name
(GenBank) FAD-dependent monooxygenase
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Organism
agra  Actinomadura graeca
Pathway
agra00253  Tetracycline biosynthesis
agra01057  Biosynthesis of type II polyketide products
agra01100  Metabolic pathways
agra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agra00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    AGRA3207_005106
   00253 Tetracycline biosynthesis
    AGRA3207_005106
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:agra01008]
    AGRA3207_005106
Enzymes [BR:agra01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.38  anhydrotetracycline 6-monooxygenase
     AGRA3207_005106
    1.14.13.234  5a,11a-dehydrotetracycline 5-monooxygenase
     AGRA3207_005106
Polyketide biosynthesis proteins [BR:agra01008]
 Polyketide tailoring proteins
  Oxygenase
   AGRA3207_005106
SSDB
Motif
Pfam: FAD_binding_3 DAO Pyr_redox Pyr_redox_2 NAD_binding_8 HI0933_like FAD_binding_2 Lycopene_cycl Pyr_redox_3 Thi4
Other DBs
NCBI-ProteinID: QXJ23888
UniProt: A0A8F5BEY1
LinkDB
Position
5753602..5755164
AA seq 520 aa
MSPDGRADGGTGDGEPVSEHDVVIVGGGPTGLLLACELSLAGVGAVVVERLTEPTRTSRS
LVLGQRPAECFAQRGLDWFADNPRVREFKFGLLDLTSVVPPETLPIRVQQWRMERLLEAR
ARELGVDVRRGHETVGLDQDGSGATVRVRSAAGEYRLRGSWVVGCDGAHSTVRKAAGIGF
PGTPSTTYAITGEMALVDEPFPGRVFIDLFERGIVSIVPLAPLEPGMHRVMAVQFETGPP
GRDTPVTADEQRDAVRRVGGIDLTIGEVRWLSRFGNATRLAETYRKGRVLLAGDAAHVHF
PSGGPGLNTGVQDAVNLGWKLAAEINGWAPPGLLDSYHDERHPVGARVCRNSRAQTALMH
PLDTVGPLRELFAEIMRAGQAEAGRHLIETLNGLDVRYPPAPGAQDAHPLIGRRVPHVTL
NTPEGPIPFAHTLHSARGVLLDLSGGGLDRAGIAGWRDRVDLVSADPVPELAASAVLVRP
DGYAAWAGGTGAAEDTGDVAGLRSALATWFGDPVGATAAI
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgagcccggacggccgcgccgacggagggaccggtgacggggaaccggtatcggagcac
gacgtcgtcatcgtcggcggcggccccaccggcctgctgctcgcctgcgagctgagcctg
gccggggtcggcgccgtcgtcgtcgagcgcctcaccgagcccacccgcacctcgcggtca
ctggtcctcgggcagcgtccggccgaatgcttcgcccagcggggcctcgactggttcgcg
gacaacccgcgggtgcgcgagttcaagttcgggctgctcgacctcacctcggtcgtgccg
cccgagacgctgccgatccgcgtccagcagtggcgcatggagcggcttctggaggcgcgc
gcccgcgagctgggcgtggacgtccgccggggccacgagacggtcggcctcgaccaggac
ggctcgggcgccacggtgcgcgtgcgatccgcggcgggcgagtaccggttgcgcggctcc
tgggtcgtgggctgcgacggggcgcacagcacggtccgcaaggcggccgggatcggcttc
ccggggaccccctcgaccacgtacgcgatcaccggggagatggccctcgtcgacgagccg
ttcccgggacgcgtcttcatcgacctgttcgagcgcggcatcgtctccatcgtcccgctc
gcgcccctcgaaccgggcatgcaccgggtcatggccgtccagttcgagaccggcccgccc
ggccgggacacgccggtgaccgccgacgagcagcgcgacgccgtccggcgcgtcggcggc
atcgacctgacgatcggcgaggtgcgctggctgtcgcggttcggcaacgcgacccgcctg
gccgagacctaccgcaagggccgcgtcctcctggcgggcgacgccgcccacgtccacttc
ccgtccggcgggcccgggctgaacaccggcgtccaggacgcggtcaacctcggctggaag
ctcgccgccgagatcaacggctgggcgccgccgggcctgctcgacagctaccacgatgag
cgccacccggtcggcgcgcgcgtgtgccgcaacagccgcgcccagaccgcgctgatgcac
ccgctcgacaccgtcgggccgctccgtgagctgttcgccgagatcatgcgggcgggccag
gccgaggcgggccggcacctgatcgagaccttgaacgggctggacgtccgctaccctccc
gcgcccggcgcgcaggacgcgcacccgctgatcggacggcgcgtcccgcacgtcacgctg
aacacgcccgaggggccgatcccgttcgcgcacaccctgcactccgcgcgcggcgtgctg
ctcgacctgtccggcggcgggctcgaccgggccgggatcgcgggatggcgggaccgggtg
gatctggtctccgcggatccggtccccgaactcgcggcctcggccgtgctcgtccgcccc
gacggctacgccgcctgggccgggggcaccggcgccgccgaagacaccggcgacgtcgcg
gggctgcgttcggcgctcgcgacctggttcggcgatcccgtcggcgccacggccgcgatc
tga

DBGET integrated database retrieval system