KEGG   Apium graveolens (celery): 141668569
Entry
141668569         CDS       T11340                                 
Name
(RefSeq) uncharacterized protein LOC141668569
  KO
K03094  S-phase kinase-associated protein 1
Organism
agrv  Apium graveolens (celery)
Pathway
agrv03083  Polycomb repressive complex
agrv04120  Ubiquitin mediated proteolysis
agrv04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:agrv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    141668569
   04120 Ubiquitin mediated proteolysis
    141668569
  09126 Chromosome
   03083 Polycomb repressive complex
    141668569
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:agrv04131]
    141668569
   04121 Ubiquitin system [BR:agrv04121]
    141668569
   03036 Chromosome and associated proteins [BR:agrv03036]
    141668569
Membrane trafficking [BR:agrv04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    141668569
Ubiquitin system [BR:agrv04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     141668569
   Cul7 complex
     141668569
Chromosome and associated proteins [BR:agrv03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     141668569
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     141668569
SSDB
Other DBs
NCBI-GeneID: 141668569
NCBI-ProteinID: XP_074331602
LinkDB
Position
6:complement(6866351..6868255)
AA seq 127 aa
MELTVLVQSSDGQVFEVEKKPILMSVSIAKELLSRPKSDHNSPIVLHQIDGKTLNKVIEY
CKHHCVPYSTLEDEAVIDSLNAFDAQFVDVDPTTFCTLVRAARDLKIDKLQDLICRSLLK
KIKGKNH
NT seq 384 nt   +upstreamnt  +downstreamnt
atggagttaacggtactcgtccaaagttccgatggacaggtttttgaggtagagaaaaag
ccaattctcatgtccgtgtcgatcgcgaaagagcttctatcaaggccaaagagcgatcac
aattcccccattgtgcttcatcaaatcgatggcaagaccttgaataaggttattgaatac
tgcaaacatcattgtgtaccctattctaccctcgaagacgaggctgtcatcgattctctc
aacgcttttgatgctcagtttgttgatgttgatccgaccactttctgtactctcgttcga
gctgctcgtgacctcaaaattgataaattgcaggatctgatatgtcgatcattgttaaag
aagatcaaggggaaaaatcattag

DBGET integrated database retrieval system