Apium graveolens (celery): 141672067 Help Entry 141672067         CDS       T11340                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism agrv  Apium graveolens (celery) Pathway agrv04145   Phagosome agrv04148   Efferocytosis agrv04517   IgSF CAM signaling agrv04518   Integrin signaling agrv04620   Toll-like receptor signaling pathway agrv05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:agrv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     141672067    04518 Integrin signaling     141672067  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     141672067    04148 Efferocytosis     141672067  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     141672067  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     141672067  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:agrv04131]     141672067   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:agrv04147]     141672067    04031 GTP-binding proteins [BR:agrv04031]     141672067 Membrane trafficking [BR:agrv04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     141672067  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     141672067   Macropinocytosis    Ras GTPases     141672067  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     141672067 Exosome [BR:agrv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141672067   Exosomal proteins of other body fluids (saliva and urine)    141672067   Exosomal proteins of colorectal cancer cells    141672067   Exosomal proteins of bladder cancer cells    141672067 GTP-binding proteins [BR:agrv04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     141672067 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C B12-binding Motif Other DBs NCBI-GeneID:  141672067 NCBI-ProteinID:  XP_074334670 LinkDB All DBs Position 1:complement(178166389..178169328) Genome browser AA seq 201 aa AA seqDB search MGSNVGSTTKFIKCVTVGDGAVGKTCLLISYTSNTFPNDYVPTVFDNFSANVVVDGKTIN LGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKPSFENIAKKWVPELRHYAPSIPIVL VGTKLDLREDKQFQLDYPGASVISTEQGDELKKQIGAVAYIECSSKTQQNVKAVFDAAIK VVLHPPKTKKEKRKHKGCHII NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atgggtagtaatgttggcagtacaacaaagtttataaaatgtgttacagttggtgatgga gctgttggcaagacttgtcttcttatatcttacactagcaacacctttcctaatgattat gtgcctacagtgtttgataacttcagtgcaaatgttgttgttgatgggaagactataaac cttggtctatgggatactgctggtcaagaagactataacaggttaaggcctcttagttac agaggagctgatgttttcatcctggctttctctctcattagcaagcctagctttgagaac attgctaaaaagtgggtcccagagcttaggcattatgctccatcgatacccattgttctt gtgggtaccaaactagatttgagagaggataaacaatttcagttggattacccgggtgca tctgtcatttccactgaacagggtgatgaattaaagaagcaaataggtgcagtggcatac atagagtgcagctccaagacacagcagaatgtgaaggctgtgtttgatgctgcaatcaag gtggtccttcatcctccgaaaaccaaaaaggagaagcgaaaacataaaggttgtcatatt atatga

DBGET integrated database retrieval system