Apium graveolens (celery): 141703773 Help Entry 141703773         CDS       T11340                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism agrv  Apium graveolens (celery) Brite KEGG Orthology (KO) [BR:agrv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:agrv03036]     141703773   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:agrv04147]     141703773 Chromosome and associated proteins [BR:agrv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     141703773 Exosome [BR:agrv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141703773 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  141703773 NCBI-ProteinID:  XP_074363302 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MARTKQTARKSIGGKVPRKPLTHKVARMRAPTTGAYRKPHRYRPGTVALREIRKYQKTTE LLILKLPFQRLVREIAQGIKVN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcaaactgctcgtaaatctattggaggaaaggttcctcgaaagccg ctcacacacaaggttgctcgtatgcgtgctccaacaactggtgcctataggaagccacat agataccgccctggaacagttgcccttcgtgagatccgtaagtatcagaagactactgag cttttgatattaaaacttccattccagaggcttgtacgtgaaattgctcaaggaattaag gttaattag

DBGET integrated database retrieval system