KEGG   Agrobacterium sp. 13-2099-1-2: A6U84_06525
Entry
A6U84_06525       CDS       T11288                                 
Symbol
tatB
Name
(GenBank) Sec-independent protein translocase protein TatB
  KO
K03117  sec-independent protein translocase protein TatB
Organism
agrz  Agrobacterium sp. 13-2099-1-2
Pathway
agrz03060  Protein export
agrz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:agrz00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    A6U84_06525 (tatB)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A6U84_06525 (tatB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:agrz02044]
    A6U84_06525 (tatB)
Secretion system [BR:agrz02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   A6U84_06525 (tatB)
SSDB
Motif
Pfam: TatA_B_E
Other DBs
NCBI-ProteinID: UZX42955
LinkDB
Position
Circular:complement(1318172..1318900)
AA seq 242 aa
MFDIGWSELLVIAVVLIVVVGPKDLPPMIRAFGKTMAGLRKMAGDFRTQFDEALKEADMD
DVRQTISDVRNLNPTNSLRDAMNPLRQLGNEIKSDLQKATAAPDAMSSTAAPATSEPVAP
LVSVPEPEMKLPDVAPAVVPTPSASSPVTAVAAAEEKPKRARAKSVATVEAEAVAAKPKR
TTRSKPAAAPVEEAAVLKPTVKAVAKKVAVRKAAAEKAVAVADAKPAKPARTKAAKPKKD
EA
NT seq 729 nt   +upstreamnt  +downstreamnt
atgtttgatatcggttggagcgagcttctggtgatcgcggtcgttttgatcgtggtcgtc
ggccccaaggacttgccgcccatgatccgcgccttcggtaagacgatggccggccttcgc
aagatggcgggggatttccgcacgcagttcgacgaggccttgaaagaggcagacatggac
gatgtgcggcagacgatctccgatgtgcgcaatctcaacccgaccaactcgctgcgcgat
gctatgaacccgcttcgccagctcggcaacgaaatcaagtccgatctccagaaggcgaca
gccgctcccgatgcgatgtcgtcgacagcagcacctgcaacaagtgagccggtggctcct
cttgtcagtgtgccggagcccgagatgaagcttccggatgtggcgcctgcggtggttccc
acgccttctgcgtcttcgccggttactgcggttgctgctgcggaagaaaagccgaagcgt
gcgcgtgcgaaatctgttgcgaccgttgaagccgaagcggttgccgccaagccgaagcgc
accacccgcagcaagcctgccgcagcgcctgttgaagaagctgctgtcttgaagccgacc
gtgaaggctgtcgccaaaaaggttgctgtcaggaaagcggcagcggagaaggcggttgcc
gttgcggatgccaaaccggccaaaccggcaagaaccaaggctgcaaagcccaaaaaggat
gaagcatga

DBGET integrated database retrieval system