Agrobacterium sp. 13-2099-1-2: A6U84_19030 Help Entry A6U84_19030       CDS       T11288                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism agrz  Agrobacterium sp. 13-2099-1-2 Pathway agrz00260   Glycine, serine and threonine metabolism agrz01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:agrz00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     A6U84_19030 Enzymes [BR:agrz01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      A6U84_19030     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      A6U84_19030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  UZX44174 LinkDB All DBs Position Linear:1222157..1222471 Genome browser AA seq 104 aa AA seqDB search MLLIHCPYCREDRSELEFRWAGEAHIARPENIADISDEAFAEYFFIRDNDKGLVFERWRH IHGCGRFFNAARDSVSDKFLMTYKAGEPKPDADAVLSAQKGAAQ NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcttctgatccattgcccttattgccgggaagaccgttccgaactcgaatttcgctgg gcgggcgaagcccatatcgcccggccggaaaacattgccgatatttcggacgaggccttt gccgaatatttcttcattcgcgacaatgacaaaggtctcgttttcgagcgctggcgccac attcacggttgcggccgctttttcaacgccgcgcgcgattccgtcagcgacaaattcctg atgacctacaaggcaggcgagccgaaaccggatgccgacgcggttctttccgcccaaaag ggagctgcgcaatga

DBGET integrated database retrieval system