Aphis gossypii (cotton aphid): 114119852 Help Entry 114119852         CDS       T05869                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ags  Aphis gossypii (cotton aphid) Pathway ags04013   MAPK signaling pathway - fly ags04145   Phagosome ags04148   Efferocytosis ags04310   Wnt signaling pathway ags04620   Toll-like receptor signaling pathway ags05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ags00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     114119852    04310 Wnt signaling pathway     114119852  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     114119852    04148 Efferocytosis     114119852  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114119852  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     114119852  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ags04131]     114119852   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ags04147]     114119852    04031 GTP-binding proteins [BR:ags04031]     114119852 Membrane trafficking [BR:ags04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     114119852  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     114119852   Macropinocytosis    Ras GTPases     114119852  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     114119852 Exosome [BR:ags04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114119852   Exosomal proteins of other body fluids (saliva and urine)    114119852   Exosomal proteins of colorectal cancer cells    114119852   Exosomal proteins of bladder cancer cells    114119852 GTP-binding proteins [BR:ags04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     114119852 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  114119852 NCBI-ProteinID:  XP_027837374 LinkDB All DBs Position 3:30136911..30140525 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTSNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKETIDKLKEKKLTAITYPQGLSMAKEIGAVKYLECSALTQKGLKIVFDEAIRAVLCPV LPVKPKRKCTII NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagccatcaagtgtgtcgtagtcggcgacggagcggttggtaaaacatgtttactc attagttatacaagcaatgcatttcctggagaatatatacccactgtatttgataactat tcagccaatgttatggttgatggaaaacctataaacttaggattgtgggatactgctggc caagaagattatgataggcttaggcctctttcatatccacaaacagatgtgtttcttata tgtttttcattagtaaatcctgcatcatttgaaaatgtgcgggcaaaatggtatcctgaa gttcgacatcattgtccaagtactccaattattttagttggtactaaacttgatctacga gaggataaagaaacaattgataaactgaaagaaaaaaagttaactgctattacatatcca cagggtttatcaatggccaaagaaattggagcagtgaagtacttggaatgtagtgctttg actcaaaaaggtctaaaaattgtttttgatgaagccattagagcagttttatgtcctgta ctgccagttaagccaaaacgtaaatgcacaataatttaa

DBGET integrated database retrieval system