Aphis gossypii (cotton aphid): 114120744 Help Entry 114120744         CDS       T05869                                  Name (RefSeq) LIRP   KO K04526   insulin Organism ags  Aphis gossypii (cotton aphid) Pathway ags04068   FoxO signaling pathway ags04081   Hormone signaling ags04140   Autophagy - animal ags04150   mTOR signaling pathway ags04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:ags00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     114120744    04150 mTOR signaling pathway     114120744   09133 Signaling molecules and interaction    04081 Hormone signaling     114120744  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114120744  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     114120744  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ags04052]     114120744 Cytokines and neuropeptides [BR:ags04052]  Neuropeptides   Unclassified    114120744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  114120744 NCBI-ProteinID:  XP_027838558 LinkDB All DBs Position 1:complement(1629389..1631294) Genome browser AA seq 125 aa AA seqDB search MKISVHLSILLLTLVIKIVIANANLQLPSRQYCGSSLANIMQIVCKNKYNGPSHGKKRNE IDSDVLDYKDLEDYNAIDYPYQSRQEAMLFMPTRIVRSSKRTIIDECCRRPCLISELKSY CANQD NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgaagatcagtgtacatttgagtatactcctcttaacattagtcatcaaaattgtaata gccaatgctaacctacaactaccttcacgacaatattgtggttctagtttggcaaacata atgcaaattgtatgtaaaaacaaatacaatggtccatcacatggaaaaaaacgaaatgag attgattcagatgtattggattataaagacctagaagactataatgcaattgactaccca taccaatcaagacaagaagcaatgttatttatgcccacacgtatagtacgctcttctaaa agaactattatcgacgaatgttgccgcagaccctgtttaatatctgaactaaaaagttat tgtgctaatcaagattaa

DBGET integrated database retrieval system