Aphis gossypii (cotton aphid): 114123296 Help Entry 114123296         CDS       T05869                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism ags  Aphis gossypii (cotton aphid) Pathway ags04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ags00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114123296  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ags04121]     114123296    03400 DNA repair and recombination proteins [BR:ags03400]     114123296 Ubiquitin system [BR:ags04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      114123296    Cul5 complex      114123296 DNA repair and recombination proteins [BR:ags03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      114123296 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  114123296 NCBI-ProteinID:  XP_027842015 LinkDB All DBs Position 2:26126185..26128932 Genome browser AA seq 116 aa AA seqDB search MDAFMMIQRKKLTIFTDAKDNILVNELKKIIGCIIKVAPANQQLYYKDEIMDETKTLTEC GLNSSIAKAQSPATIGLAVRMENGEFEPLEMVPYSLPPELPYVMKNQETNGQEPPM NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggacgccttcatgatgatacaacgaaaaaagctaaccatatttactgatgctaaagac aatatattggttaatgaactcaaaaagattattggatgtatcattaaagtagcaccagca aatcaacaactttactacaaagacgaaattatggatgagacaaaaactttgacagaatgt ggtctgaattctagtattgctaaggcacaaagtccagctactattggtttagcagtgaga atggaaaatggagaatttgagccattggaaatggtaccatactcactgccaccagagttg ccatatgtcatgaaaaaccaagaaactaatggtcaagaaccacccatgtaa

DBGET integrated database retrieval system