Agrobacterium sp. 33MFTa1.1: EYD00_03795 Help Entry EYD00_03795       CDS       T05906                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism agt  Agrobacterium sp. 33MFTa1.1 Pathway agt01100   Metabolic pathways agt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EYD00_03795    00074 Mycolic acid biosynthesis     EYD00_03795   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EYD00_03795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  QBJ12593 LinkDB All DBs Position circular:744217..744453 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgtaattgatcatcttggcgttgacgcc gacaaggttgttgaaggcgccagcttcattgacgatctgggcgctgattcgctcgatacc gttgaactggtcatggctttcgaagaagaatttggcgttgaaattcccgacgacgctgcg gattcgatcctgaccgtcggcgacgctgtcaagttcatcgagaaggcccaggcctga

DBGET integrated database retrieval system