Agrobacterium sp. 33MFTa1.1: EYD00_25190 Help Entry EYD00_25190       CDS       T05906                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism agt  Agrobacterium sp. 33MFTa1.1 Brite KEGG Orthology (KO) [BR:agt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:agt03032]     EYD00_25190    03036 Chromosome and associated proteins [BR:agt03036]     EYD00_25190    03400 DNA repair and recombination proteins [BR:agt03400]     EYD00_25190 DNA replication proteins [BR:agt03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EYD00_25190 Chromosome and associated proteins [BR:agt03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EYD00_25190 DNA repair and recombination proteins [BR:agt03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EYD00_25190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  QBJ16743 LinkDB All DBs Position p_JBx_073812:complement(372179..372457) Genome browser AA seq 92 aa AA seqDB search MTTTNEIADKIASEHGLTKVQGKAIVEAVIASITEAAVAGNETSLPGFGKFKVKDTPERE ARNPATGATIKVAAAKKLAFTPAKALKDALNK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccacgaccaatgaaattgccgacaagattgccagcgagcatggcctcaccaaggtt cagggaaaagctatcgtagaggcggtgatcgcttcgatcaccgaggcggccgtggccggc aacgagacatcgctgcccggcttcggcaaattcaaggtgaaggacactccggagcgcgag gcgcgtaacccggcgactggcgcgacgatcaaggttgccgccgcgaaaaagctggctttt acgcctgccaaggctctcaaggatgcgctgaacaagtaa

DBGET integrated database retrieval system