Acinetobacter guillouiae: AS4_10680 Help Entry AS4_10680         CDS       T06251                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism agu  Acinetobacter guillouiae Brite KEGG Orthology (KO) [BR:agu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:agu03110]     AS4_10680 (groS)    03029 Mitochondrial biogenesis [BR:agu03029]     AS4_10680 (groS) Chaperones and folding catalysts [BR:agu03110]  Heat shock proteins   HSP10    AS4_10680 (groS) Mitochondrial biogenesis [BR:agu03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     AS4_10680 (groS) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Lipoprotein_22 Hexapep_2 Motif Other DBs NCBI-ProteinID:  BAP36008 UniProt:  A0ACD7VC09 LinkDB All DBs Position 1151325..1151615 Genome browser AA seq 96 aa AA seqDB search MSKIRPLHDNVVIRRVEKETKTAGGLILSTSAAEQPAQGEILAVGNGKITDNGVRALDVK VGDNVLFGAYAGTKVKVDGEELLVMKESDILAVLEG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgagcaagattcgtcctttacatgacaacgttgtgatccgccgtgttgaaaaagaaact aaaacagcaggtggtttgattttaagtacttctgcagctgaacagcctgctcaaggtgaa attcttgctgtaggtaatggcaaaatcactgataacggtgtacgcgctttagacgttaaa gtcggcgataacgtactgtttggtgcttatgcgggtactaaagttaaagttgatggtgaa gaacttcttgtgatgaaagaatctgacattttagcggtattggaaggttaa

DBGET integrated database retrieval system