Agromyces aureus: ATC03_10150 Help Entry ATC03_10150       CDS       T04413                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism agy  Agromyces aureus Pathway agy03060   Protein export agy03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:agy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     ATC03_10150  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     ATC03_10150  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:agy02044]     ATC03_10150 Secretion system [BR:agy02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    ATC03_10150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ANJ27033 UniProt:  A0A191WFS3 LinkDB All DBs Position 2296302..2296565 Genome browser AA seq 87 aa AA seqDB search MFANLTGWHFLIILVIILLLFGAPKLPALARSLGQSMKILKSEVRDPAADGKADSTGDVP PAGDSSASTGTNSADGTAKKPDSASGA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgttcgcaaacctcaccggatggcacttcctgatcatcctggtcatcatcctgctgctc ttcggcgcgcccaagcttccggcgctcgcgcggagcctcgggcagtcgatgaagatcctc aagtccgaggtgcgcgaccccgccgccgacggcaaggccgactccacgggagacgtcccg cccgcgggcgacagctccgcgagcaccggcacgaactcggccgacggcaccgcgaagaag cccgattccgcttcgggcgcctga

DBGET integrated database retrieval system