Agarivorans sediminis: M0C34_03425 Help Entry M0C34_03425       CDS       T08089                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism agz  Agarivorans sediminis Pathway agz01100   Metabolic pathways agz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:agz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M0C34_03425    00074 Mycolic acid biosynthesis     M0C34_03425   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M0C34_03425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF2659 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UPW20678 LinkDB All DBs Position 748584..748838 Genome browser AA seq 84 aa AA seqDB search MMTRDEIYQVLRDILVQEFEVPEDDISLDANMYQDLDLDSIDAVDLVVKLQQITGKKIQP NEFKSARTVADVIDALERLVSDAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt attatgactagagatgaaatataccaagtattgcgagatatcttagtacaagaatttgaa gtacccgaggatgatatttctttggacgcaaacatgtaccaagacttagacttagacagt attgatgccgtcgatttggtcgttaagctacagcagatcaccggtaaaaaaatccaacct aacgaattcaagtcggcaagaactgttgccgatgttattgatgccttagagcgattagtt agcgatgccgcgtaa

DBGET integrated database retrieval system