Aeromonas hydrophila YL17: AI20_02345 Help Entry AI20_02345        CDS       T03186                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ahd  Aeromonas hydrophila YL17 Pathway ahd01100   Metabolic pathways ahd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AI20_02345    00074 Mycolic acid biosynthesis     AI20_02345   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AI20_02345 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AHV34078 LinkDB All DBs Position complement(113996..114244) Genome browser AA seq 82 aa AA seqDB search MTRDDIFAQIKAALVELFEVDEEAVTPEARLYQDLELDSIDAIDLVVHLQKLTGKKIKPE EFKSVRSVNDVVDAVERLLADA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacccgcgacgacatctttgcccagatcaaggctgccctcgtcgagctgttcgaagtc gacgaagaggccgtcacccccgaggcccgcctctatcaggatctcgagctcgacagcata gacgccatcgatctggtggtgcacctgcagaagctgaccggcaagaagatcaagccggaa gagttcaagtcggtgcgcagcgtcaacgacgtggtggatgcggtcgagcgtctgctggcc gacgcctga

DBGET integrated database retrieval system