Aeromonas hydrophila YL17: AI20_08275 Help Entry AI20_08275        CDS       T03186                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ahd  Aeromonas hydrophila YL17 Pathway ahd01100   Metabolic pathways ahd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ahd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AI20_08275    00074 Mycolic acid biosynthesis     AI20_08275   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AI20_08275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 EutQ HLH MAP Motif Other DBs NCBI-ProteinID:  AHV35184 LinkDB All DBs Position complement(3529871..3530107) Genome browser AA seq 78 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEDVKNAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYITANQE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcatcatcgaacaactgggtgttaaagaa gaagacgttaagaacgctgcctccttcgtcgacgacctgggcgctgactctttggatacc gttgaactggtaatggcgctggaagaagaattcgataccgaaattcctgatgaagaagcc gagaagatcaccactgttcaagcggctatcgactacatcaccgctaatcaggaataa

DBGET integrated database retrieval system